Skip to product information
1 of 1

Human FIS1 Protein, His tag

Human FIS1 Protein, His tag

Catalog Number: S0A0178 Brand: Starter
Price:
Regular price $79.00 SGD
Regular price Sale price $79.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Mitochondrial fission 1 protein, FIS1 homolog (hFis1), Tetratricopeptide repeat protein 11 (TPR repeat protein 11), TTC11
Accession Q9Y3D6
Amino Acid Sequence

Protein sequence (Q9Y3D6, Met1-Gly122, with C-His tag) MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDG

Expression System HEK293
Molecular Weight Predicted MW: 15.9 kDa Observed MW: 16 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Mitochondrial fission 1 protein (Fis1) is a key regulator in mitochondrial fission, a process critical for maintaining mitochondrial dynamics and cellular homeostasis. Localized to the outer mitochondrial membrane, Fis1 recruits cytosolic dynamin-related proteins (e.g., Drp1) to drive mitochondrial fragmentation. Dysregulation of Fis1-mediated fission is linked to various cellular stress responses, apoptosis, and diseases such as neurodegenerative disorders and cancer. Research focuses on its interaction networks, post-translational modifications, and roles in mitochondrial quality control, shedding light on mechanisms underlying mitochondrial dysfunction and potential therapeutic targets.

Picture

SDS-PAGE

2μg(R: reducing conditions)