Skip to product information
1 of 1

Human CCL4 Protein, hFc tag

Human CCL4 Protein, hFc tag

Catalog Number: S0A4065 Reactivity: Human Conjugation: Unconjugated Brand: Starter
Price:
Regular price $288.00 SGD
Regular price Sale price $288.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms C-C motif chemokine 4, G-26 T-lymphocyte-secreted protein, HC21, Lymphocyte activation gene 1 protein (LAG-1), MIP-1-beta (1-69), Macrophage inflammatory protein 1-beta (MIP-1-beta), PAT 744, Protein H400, SIS-gamma, Small-inducible cytokine A4, T-cell activation protein 2 (ACT-2), LAG1, MIP1B, SCYA4
Accession P13236
Amino Acid Sequence

Protein sequence (P13236, Ala24-Asn92, with C-hFc tag) APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN

Expression System HEK293
Molecular Weight Predicted MW: 33.9 kDa Observed MW: 40 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-hFc tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

CCL4 is a small cytokine that belongs to the CC chemokine subfamily. CCL4 is being secreted under mitogenic signals and antigens and hereby acts as a chemoattractant for natural killer cells, monocytes and various other immune cells in the site of inflamed or damaged tissue. CCL4 is produced by: monocytes, B cells, T cells, NK cells, dendritic cells, neutrophils, fibroblasts, endothelial cells such as vascular smooth muscle cells, brain microvessel endothelial cells, fetal microglia and epithelial cells. CCL4 is a major HIV-suppressive factor produced by CD8+ T cells.

Picture

SDS-PAGE

2μg(R: reducing conditions)