Skip to product information
1 of 1

Human CCL22 Protein, hFc tag

Human CCL22 Protein, hFc tag

Catalog Number: S0A4064 Reactivity: Human Conjugation: Unconjugated Brand: Starter
Price:
Regular price $307.00 SGD
Regular price Sale price $307.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms C-C motif chemokine 22, CC chemokine STCP-1, MDC (1-69), Macrophage-derived chemokine, Small-inducible cytokine A22, Stimulated T-cell chemotactic protein 1, MDC, SCYA22
Accession O00626
Amino Acid Sequence

Protein sequence (O00626, Gly25-Gln93, with C-hFc tag) GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ

Expression System HEK293
Molecular Weight Predicted MW: 34.2 kDa Observed MW: 40 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-hFc tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

C-C motif chemokine 22 is a protein that in humans is encoded by the CCL22 gene. The protein encoded by this gene is secreted by dendritic cells and macrophages, and elicits its effects on its target cells by interacting with cell surface chemokine receptors such as CCR4. The gene for CCL22 is located in human chromosome 16 in a cluster with other chemokines called CX3CL1 and CCL17. Involved in antimicrobial humoral immune response mediated by antimicrobial peptide. It is biomarker of several diseases, including arthritis (multiple), cervical squamous cell carcinoma, lung disease (multiple), pleural tuberculosis and rhinitis.

Picture

SDS-PAGE

2μg(R: reducing conditions)