Skip to product information
1 of 1

Human CCL17 Protein, hFc tag

Human CCL17 Protein, hFc tag

Catalog Number: S0A4061 Reactivity: Human Conjugation: Unconjugated Brand: Starter
Price:
Regular price $307.00 SGD
Regular price Sale price $307.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms C-C motif chemokine 17, CC chemokine TARC, Small-inducible cytokine A17, Thymus and activation-regulated chemokine, SCYA17, TARC
Accession Q92583
Amino Acid Sequence

Protein sequence (Q92583, Ala24-Ser94, with C-hFc tag) ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS

Expression System HEK293
Molecular Weight Predicted MW: 34.2 kDa Observed MW: 34, 35 kDa
Purity >90% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-hFc tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

CCL17 is a powerful chemokine produced in the thymus and by antigen-presenting cells like dendritic cells, macrophages, and monocytes. CCL17 plays a complex role in cancer. It attracts T-regulatory cells allowing for some cancers to evade an immune response. However, in other cancers, such as melanoma, an increase in CCL17 is linked to an improved outcome. CCL17 has also been linked to autoimmune and allergic diseases. CCL17 as well as its partner chemokine CCL22 induce chemotaxis in T-helper cells. They do this by binding to CCR4. CCL17 was the first CC chemokine identified that interacted with T cells with high affinity. CCL17 was also found to interact with monocytes, but with less affinity. It does not interact with granulocytes.

Picture

SDS-PAGE

2μg(R: reducing conditions)