Skip to product information
1 of 1

Human ADAM23 Protein, His tag

Human ADAM23 Protein, His tag

Catalog Number: S0A0181 Brand: Starter
Price:
Regular price $111.00 SGD
Regular price Sale price $111.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Disintegrin and metalloproteinase domain-containing protein 23, ADAM 23, Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3 (MDC-3), MDC3
Accession O75077
Amino Acid Sequence

Protein sequence (O75077, Ser60-His585, with C-His tag) SRPRAWGAAAPSAPHWNETAEKNLGVLADEDNTLQQNSSSNISYSNAMQKEITLPSRLIYYINQDSESPYHVLDTKARHQQKHNKAVHLAQASFQIEAFGSKFILDLILNNGLLSSDYVEIHYENGKPQYSKGGEHCYYHGSIRGVKDSKVALSTCNGLHGMFEDDTFVYMIEPLELVHDEKSTGRPHIIQKTLAGQYSKQMKNLTMERGDQWPFLSELQWLKRRKRAVNPSRGIFEEMKYLELMIVNDHKTYKKHRSSHAHTNNFAKSVVNLVDSIYKEQLNTRVVLVAVETWTEKDQIDITTNPVQMLHEFSKYRQRIKQHADAVHLISRVTFHYKRSSLSYFGGVCSRTRGVGVNEYGLPMAVAQVLSQSLAQNLGIQWEPSSRKPKCDCTESWGGCIMEETGVSHSRKFSKCSILEYRDFLQRGGGACLFNRPTKLFEPTECGNGYVEAGEECDCGFHVECYGLCCKKCSLSNGAHCSDGPCCNNTSCLFQPRGYECRDAVNECDITEYCTGDSGQCPPNLH

Expression System CHO
Molecular Weight Predicted MW: 61.2 kDa (pro) & 34.9 kDa (mature) Observed MW: 40-50 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

ADAM23 (A Disintegrin And Metalloproteinase 23) is a member of the ADAM family, known for its roles in cell adhesion and signaling. Unlike other ADAMs, it lacks proteolytic activity but interacts with integrins and extracellular matrix proteins, influencing neuronal development and synaptic plasticity. ADAM23 is highly expressed in the brain and has been linked to epilepsy and neurodegenerative disorders. It also plays a role in cancer progression, where its dysregulation affects tumor cell migration and metastasis.

Picture

SDS-PAGE

2μg(R: reducing conditions)