1μg (R: reducing condition, N: non-reducing condition).
Fc γ RIIb/CD32b GST Tag Protein, Human
Fc γ RIIb/CD32b GST Tag Protein, Human
Price:
Regular price
$404 USD
Regular price
Sale price
$404 USD
Unit price
per
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details
Product Details
Product Details
Product Specification
| Species | Human |
| Antigen | Fc γ RIIB/CD32b |
| Synonyms | FCGR2B, FCG2, IGFR2, CDw32 |
| Accession | P31994 |
| Amino Acid Sequence | Ala46-Pro217, with N-terminal GST Tag MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKGGGSGGGSAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAP |
| Expression System | HEK293 |
| Molecular Weight | 43-55kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | GST Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1. Ali Roghanian, Richard J Stopforth, Lekh N Dahal, Mark S Cragg. New revelations from an old receptor: Immunoregulatory functions of the inhibitory Fc gamma receptor, Fc γ RIIB (CD32B). J Leukoc Biol. 2018 Feb 6. Online ahead of print. |
Background
The Fc gamma receptor IIB (Fc γ RIIB/CD32B) was generated million years ago during evolution. It is the sole inhibitory receptor for IgG, and has long been associated with the regulation of humoral immunity and innate immune homeostasis. However, new and surprising functions of Fc γ RIIB are emerging. In particular, Fc γ RIIB has been shown to perform unexpected activatory roles in both immune-signaling and monoclonal antibody (mAb) immunotherapy. Furthermore, although ITIM signaling is an integral part of Fc γ RIIB regulatory activity, it is now clear that inhibition/activation of immune responses can occur independently of the ITIM. In light of these new findings, we present an overview of the established and noncanonical functions of Fc γ RIIB and discuss how this knowledge might be exploited therapeutically.
Picture
Picture
SDS-PAGE
