Skip to product information
1 of 1

E. coli MBP Protein, His tag

E. coli MBP Protein, His tag

Catalog Number: S0A0132 Reactivity: E.coli Conjugation: Unconjugated Brand: Starter
Price:
Regular price $242.00 SGD
Regular price Sale price $242.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species E. coli
Synonyms Maltose/maltodextrin-binding periplasmic protein, MMBP, Maltodextrin-binding protein, Maltose-binding protein (MBP), malE
Accession P0AEX9
Amino Acid Sequence

Protein sequence (P0AEX9, Lys27-Thr392, with C-His tag) KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQT

Expression System E.coli
Molecular Weight Predicted MW: 41.8 kDa Observed MW: 42 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Maltose-binding protein (MBP) is a part of the maltose/maltodextrin system of Escherichia coli, which is responsible for the uptake and efficient catabolism of maltodextrins. It is a complex regulatory and transport system involving many proteins and protein complexes. MBP has an approximate molecular mass of 42.5 kilodaltons. MBP is used to increase the solubility of recombinant proteins expressed in E. coli. The fusion of proteins with MBP usually enhances their solubility and facilitates their proper folding. In addition, such fusions can facilitate the crystallization of difficult proteins, e.g. membrane proteins. MBP can itself be used as an affinity tag for purification of recombinant proteins.

Picture

SDS-PAGE

2 μg(R: reducing conditions)