Skip to product information
1 of 1

CNTF Protein, Human

CNTF Protein, Human

Catalog Number: UA040012 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $251.00 SGD
Regular price Sale price $251.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms CNTF
Accession P26441-1
Amino Acid Sequence

Ala2-Met200, with N-terminal 6*His MHHHHHHDDDDKAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM

Expression System E.coli
Molecular Weight 26-28 kDa(Reducing)
Purity

>97% by SDS-PAGE & RP-HPLC

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag No Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris, 100mM NaCl, pH7.5
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Ciliary neurotrophic factor (CNTF) is a member of the interleukin-6 family of cytokines. CNTF is a differentiating cytokine that drives cells toward a predominantly astrocytic fate. In HD, CNTF is the most widely studied neurotrophic factor. CNTF is the first and currently the only trophic factor to enter clinical trails in HD. CNTF has trophic effects on striatal neurons as seen in both in vitro and in vivo studies. Some of the earliest studies administered CNTF to the brain by direct infusion of the protein using pumps. An infusion cannula was implanted directly into the striatum and recombinant CNTF was continuously infused using an osmotic pump. This method of CNTF administration was efficient at significantly reducing cell death within the QA-lesioned striatum. A major pitfall of this method of administration is the need to constantly infuse CNTF into striatum. Additionally, large amounts of CNTF may be needed at one time to establish adequate diffusion throughout the striatum.

Picture

SDS-PAGE

2μg(R: reducing conditions, N: non-reducing conditions).

RP-HPLC