Cholera Toxin B subunit （CTB)

Catalog Number: UA070002 Brand: UA BIOSCIENCE

Price:

$280 USD

Size: 500μg 1mg

Quantity:

For shipping services or bulk orders, you may request a quotation.

Secure checkout with

View full details

Product Details

Product Specification

Synonyms	CHOLERA TOXIN B SUBUNIT、CTB、 Cholera Toxin B subunit、CTxB、Choleragenoid
Accession	P01556
Amino Acid Sequence	MTPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Expression System	E.coli
Molecular Weight	11.8kDa(Reducing)
Purity	＞95% by SDS-PAGE & RP-HPLC
Endotoxin	<0.2EU/μg
Conjugation	Unconjugated
Physical Appearance	Lyophilized Powder
Storage Buffer	20mM Tris, 100mM NaCl, pH9.0
Reconstitution	Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability & Storage	· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution. · 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1. Nedelkoska, L., and Benjamins, J.A., Binding of cholera toxin B subunit: a surface marker for murine microglia but not oligodendrocytes or astrocytes. J. Neurosci. Res., 53, 605-612 (1998). 2. Janes, P.W., et al., Aggregation of lipid rafts accompanies signaling via the T cell antigen receptor. J. Cell Biol., 147, 447-461 (1999).

Background

Cholera toxin （CTB）belongs to the AB5 –subunit family oftoxins.The native hexameric protein has a molecular mass of ~85 kDa and contains two subunits. It consists of a single A subunit (~27.2 kDa), responsible for the ADP-ribosylation activity, and five B subunits(~11.6 kDa each), which are arranged as a pentameric ring with an apparent 5-fold symmetry and are associated with the cell surface receptor binding and subsequent internalization (transmembrane transport)of the enzymatic component.