Skip to product information
1 of 1

CD68/SR-D1 His Tag Protein, Human

CD68/SR-D1 His Tag Protein, Human

Catalog Number: UA010665 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $731.00 SGD
Regular price Sale price $731.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms GP110, LAMP4, SCARD1
Accession P34810
Amino Acid Sequence

Asn22-Ser319, with C-terminal 8*His NDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDRSGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

55-95kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. nature laboratory investigation pathobiology in focus article Published: 21 November 2016 CD68/macrosialin.

Background

CD68 is a highly glycosylated glycoprotein, which has structural similarities with lysosome associated membrane protein (LAMP) and belongs to the LAMP family. Human CD68 contains 354 amino acids (aa), with a 21 aa signal sequence and a 298 aa extracellular domain (ECD), a 25 aa transmembrane domain, and a 10 aa cytoplasmic domain. CD68 is highly expressed by blood monocytes and tissue macrophages. CD68 plays a role in macrophage phagocytosis, intracellular lysosomal metabolism, extracellular cell-cell and cell-pathogen interactions. CD68 can be used alone or in combination with other cell markers of tumor-associated macrophages as a prognostic marker for cancer patient survival, showing good predictive value.

Picture

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).