Skip to product information
1 of 4

CD27 Ligand/TNFSF7 Fc Chimera Protein, Human

CD27 Ligand/TNFSF7 Fc Chimera Protein, Human

Catalog Number: UA010611 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $557 USD
Regular price Sale price $557 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms CD27 ligand, CD27L, CD27LG, TNFSF7, CD70
Accession P32970
Amino Acid Sequence

Gln39-Pro193, with N-terminal Human IgG1 Fc PKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKIEGRQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP

Expression System HEK293
Molecular Weight

45-50kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1. Goodwin RG, Alderson MR, Smith CA, et al. Molecular and biological characterization of a ligand for CD27 defines a new family of cytokines with homology to tumor necrosis factor. Cell. 1993;73:447-456.

Background

The TNFSF7 gene (Tumor Necrosis Factor Ligand Superfamily, member 7) localized on C19p13 is a surface antigen found on activated, but not resting, T and B lymphocytes. It is a 19 amino acid protein containing a 20-amino acid hydrophilic N-terminal domain that lacks a signal sequence; an 18-amino acid hydrophobic region that presumably functions as a transmembrane anchor; and a C-terminal domain that contains 2 potential N-linked glycosylation sites is extracellular classifying TNFSF7 as a type II transmembrane protein. TNFSF7 expressed on a subset of B, T and NK cells, where it plays a costimulatory role in immune cell activation. TNFSF7 is homologous to the ligands of the TNF receptor family, including TNF-alpha, TNF-beta and the CD40 ligand, showing 19 to 24% amino acid sequence identity in the extracellular region. TNFSF7 gene expression is epigenetically down-regulated via DNA hypermethylation within its promoter region during progression in breast cancer cells in the isogenic MCF10 model.

Picture

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).

ELISA

Immobilized CD27/TNFRSF7 His Tag, Human (Cat. No. UA010124) at 2.0μg/mL (100μL/well) can bind CD27 Ligand/TNFSF7 Fc Chimera, Human (Cat. No. UA010611) with EC50 of 5.89-20.94ng/mL.


Serial dilutions of V6 Anti-Human CD70 (Cusatuzumab) were added into CD27 Ligand/TNFSF7 Fc Chimera Protein, Human (Cat. No. UA010611): Biotinylated CD27/TNFRSF7 His Tag Protein, Human binding reactions. The half maximal inhibitory concentration (IC50) is 0.069μg/mL.

Molecular Interaction

Protein A Chip captured CD27 Ligand/TNFSF7 Fc Chimera, Human (Cat. No. UA010611), can bind CD27/TNFRSF7 His Tag, Human (Cat. No. UA010124) with an affinity constant of 1.16μM as determined in SPR assay.