Skip to product information
1 of 1

AGER His Tag Protein, Human

AGER His Tag Protein, Human

Catalog Number: UA010656 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $731.00 SGD
Regular price Sale price $731.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms RAGE, Receptor for advanced glycosylation end products
Accession Q15109
Amino Acid Sequence

Ala23-Ala344, with C-terminal 8*His AQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALAGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 47-54kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Vissing H., Aagaard L., Tommerup N., Boel E. Localization of the human gene for advanced glycosylation end product-specific receptor (AGER) to chromosome 6p21.3. Genomics. 1994;24(3):606–608.
2.Yan S. D., Chen X., Fu J., et al. RAGE and amyloid-β peptide neurotoxicity in Alzheimer’s disease. Nature. 1996;382(6593):685–691.
3.Deane R., du Yan S., Submamaryan R. K., et al. RAGE mediates amyloid-β peptide transport across the blood-brain barrier and accumulation in brain. Nature Medicine. 2003;9(7):907–913.
4.Krechler T., Jáchymová M., Mestek O., Žák A., Zima T., Kalousová M. Soluble receptor for advanced glycation end-products (sRAGE) and polymorphisms of RAGE and glyoxalase I genes in patients with pancreas cancer. Clinical Biochemistry. 2010;43(10-11):882–886. 2010.04.004.

Background

AGER (advanced glycation end-product-specific receptor encodes a cell surface receptor for advanced glycation end-products (RAGE). This gene is located on the short arm of chromosome 6: 6p21.3. This locus is involved in inflammatory and immune responses and is also the locus of major histocompatibility complex III. Recently, sRAGE was demonstrated as a new biomarker for lung cancer and RAGE could be a potential therapeutic target in Alzheimer's disease. The genetic background of RAGE demonstrated that some gene polymorphisms are implicated in various pathological states, for example, diabetes complications, amplification of the inflammatory response, non-small cell lung cancer, gastric cancer, or breast cancer.

Picture

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).