Skip to product information
1 of 1

Adiponectin, His Tag, Human

Adiponectin, His Tag, Human

Catalog Number: S0A9020 Brand: Starter
Price:
Regular price $161.00 SGD
Regular price Sale price $161.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Adiponectin; 30 kDa Adipocyte Complement-Related Protein; Adipocyte complement-related 30 kDa protein; ACRP30; Adipocyte; C1q and Collagen Domain-Containing Protein; Adipose Most Abundant Gene Transcript 1 Protein; apM-1; Gelatin-Binding Protein; ADIPOQ; ACDC; ACRP30; APM1; GBP28
Accession Q15848
Amino Acid Sequence ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTNGGGSHHHHHH
Expression System HEK293
Molecular Weight 36 kDa(Reducing)
Purity >95%, by SDS-PAGE under reducing conditions
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Adiponectin(ADPN) is a hormone secreted by adipocytes that regulates energy homeostasis and glucose and lipid metabolism. Adiponectin is a new member of the family of soluble defense collagens, in hematopoiesis and immune responses. It is an important negative regulator in hematopoiesis and immune systems and raise the possibility that it may be involved in ending inflammatory responses through its inhibitory functions. Adiponectin is mapped to 3q27 and can protect the organism from systemic inflammation by promoting the clearance of early apoptotic cells by macrophages through a receptor-dependent pathway involving calreticulin. The standard product used in this kit is the product of gene recombination, consisting of 226(19-244) amino acids with the molecular mass of 36KDa after glycosylation.

Picture

SDS-PAGE

Adiponectin His Tag, Human ,2μg on SDS-PAGE under reducing and Non-reducing condition.

RP-HPLC