The KIF5A activity was detected using Ultra Luminescence technology. The reaction was performed by incubating the KIF5A protein, ATP and substrate at 25℃ for 60 min, then adding ADP-Glo reagent at 25℃ for 40 min and reading RLU signal with BMG.
KIF5A Protein
KIF5A Protein
Price:
Regular price
$700.00 SGD
Regular price
Sale price
$700.00 SGD
Unit price
per
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details
Product Details
Product Details
Product Specification
| Species | Human |
| Synonyms | KIF5A |
| Accession | Q12840 |
| Amino Acid Sequence |
M1-E340 MAETNNECSIKVLCRFRPLNQAEILRGDKFIPIFQGDDSVVIGGKPYVFDRVFPPNTTQEQVYHACAMQIVKDVLAGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIARDIFNHIYSMDENLEFHIKVSYFEIYLDKIRDLLDVTKTNLSVHEDKNRVPFVKGCTERFVSSPEEILDVIDEGKSNRHVAVTNMNEHSSRSHSIFLINIKQENMETEQKLSGKLYLVDLAGSEKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGTKSYVPYRDSKMTRILQDSLGGNCRTTMFICCSPSSYNDAETKSTLMFGQRAKTIKNTASVNLELTAE |
| Expression System | E.coli |
| Molecular Weight | 65.2 kDa |
| Purity | >85% by SDS-PAGE |
| Endotoxin | <2EU/μg |
| Conjugation | Unconjugated |
| Tag | GST Tag |
| Physical Appearance | Liquid |
| Storage Buffer | 50 mM Tris, 150 mM NaCl, 1 mM DTT, 10% glycerol, pH 7.5 |
| Stability & Storage | Stable for 12 months upon stored at -80℃ from the date of receipt. And avoid repeated freeze-thaws cycles. |
Picture
Picture
Bioactivity
