Skip to product information
1 of 2

KIF5A Protein

KIF5A Protein

Catalog Number: UA080143 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $700.00 SGD
Regular price Sale price $700.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms KIF5A
Accession Q12840
Amino Acid Sequence

M1-E340

MAETNNECSIKVLCRFRPLNQAEILRGDKFIPIFQGDDSVVIGGKPYVFDRVFPPNTTQEQVYHACAMQIVKDVLAGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIARDIFNHIYSMDENLEFHIKVSYFEIYLDKIRDLLDVTKTNLSVHEDKNRVPFVKGCTERFVSSPEEILDVIDEGKSNRHVAVTNMNEHSSRSHSIFLINIKQENMETEQKLSGKLYLVDLAGSEKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGTKSYVPYRDSKMTRILQDSLGGNCRTTMFICCSPSSYNDAETKSTLMFGQRAKTIKNTASVNLELTAE

Expression System E.coli
Molecular Weight 65.2 kDa
Purity >85% by SDS-PAGE
Endotoxin <2EU/μg
Conjugation Unconjugated
Tag GST Tag
Physical Appearance Liquid
Storage Buffer 50 mM Tris, 150 mM NaCl, 1 mM DTT, 10% glycerol, pH 7.5
Stability & Storage

Stable for 12 months upon stored at -80℃ from the date of receipt. And avoid repeated freeze-thaws cycles.

Picture

Bioactivity

The KIF5A activity was detected using Ultra Luminescence technology. The reaction was performed by incubating the KIF5A protein, ATP and substrate at 25℃ for 60 min, then adding ADP-Glo reagent at 25℃ for 40 min and reading RLU signal with BMG.