Skip to product information
1 of 2

IL-7 Protein, Human

IL-7 Protein, Human

Catalog Number: UA040118 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $236 USD
Regular price Sale price $236 USD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Interleukin-7
Accession P13232
Amino Acid Sequence

Asp26-His177 with C-terminal 6*His Tag

DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEHHHHHHH

Expression System HEK293
Molecular Weight 18-30 kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <1EU/mg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 10 mM PBS, pH 7.4.
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Proc Natl Acad Sci U S A. 1989 Jan;86(1):302-6.
2. J Biol Chem. 1997 Dec 26;272(52):32995-3000.
3. J Immunol. 1995 Jan 1;154(1):58-67.

Background

Interleukin 7(IL-7)is a mature protein of 177 amino acids with a signal sequence of 25 amino acids and a calculated mass of 17.4kDa. Recombinant human IL-7 stimulated the proliferation of murine pre-B cells and was active on cells harvested from human bone marrow that are enriched for B-lineage progenitor cells.

IL-7 is a proteinaceous biological response modifier that has a bioactive tertiary structure dependent on disulfide bond formation.

IL-7-stimulated pro-B cells partially differentiated into a pre-B cell population, on the basis of the loss of CD34 and terminal deoxynucleotidyl (TdT) expression, and the acquisition of cytoplasmic mu heavy chains.

Picture

Bioactivity

Measured in a cell proliferation assay using 2E8 cells. The EC50 for this effect is less than 1.5ng/ml.

SDS-PAGE

2μg (R: reducing conditions, N: non-reducing conditions).

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)