Measured in a cell proliferation assay using 2E8 cells. The EC50 for this effect is less than 1.5ng/ml.
Product Details
Product Details
Product Specification
Species | Human |
Synonyms | Interleukin-7 |
Accession | P13232 |
Amino Acid Sequence |
Asp26-His177 with C-terminal 6*His Tag DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEHHHHHHH |
Expression System | HEK293 |
Molecular Weight | 18-30 kDa (Reducing) |
Purity | >95% by SDS-PAGE |
Endotoxin | <1EU/mg |
Conjugation | Unconjugated |
Tag | His Tag |
Physical Appearance | Lyophilized Powder |
Storage Buffer | 10 mM PBS, pH 7.4. |
Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Reference | 1. Proc Natl Acad Sci U S A. 1989 Jan;86(1):302-6. |
Background
Interleukin 7(IL-7)is a mature protein of 177 amino acids with a signal sequence of 25 amino acids and a calculated mass of 17.4kDa. Recombinant human IL-7 stimulated the proliferation of murine pre-B cells and was active on cells harvested from human bone marrow that are enriched for B-lineage progenitor cells.
IL-7 is a proteinaceous biological response modifier that has a bioactive tertiary structure dependent on disulfide bond formation.
IL-7-stimulated pro-B cells partially differentiated into a pre-B cell population, on the basis of the loss of CD34 and terminal deoxynucleotidyl (TdT) expression, and the acquisition of cytoplasmic mu heavy chains.
Picture
Picture
Bioactivity

SDS-PAGE

2μg (R: reducing conditions, N: non-reducing conditions).

