Skip to product information
1 of 4

IL-31 Protein, Canine

IL-31 Protein, Canine

Catalog Number: UA040130 Reactivity: Canine Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $435.00 SGD
Regular price Sale price $435.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Canine
Synonyms IL-31,IL31,Interleukin-31
Accession C7G0W1
Amino Acid Sequence

Ser24-Gln159 with C terminal 8*His

MSHMAPTHQLPPSDVRKIILELQPLSRGLLEDYQKKETGVPESNRTLLLCLTSDSQPPRLNSSAILPYFRAIRPLSDKNIIDKIIEQLDKLKFQHEPETEISVPADTFECKSFILTILQQFSACLESVFKSLNSGPQHHHHHHHH

Expression System E.coli
Molecular Weight 17kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4, 5% Trehalose.
Reconstitution econstitute at 0.1-0.5mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. J Allergy Clin Immunol. 2023 Jul 13;S0091-6749(23)00888-6. Online ahead of print.
2. Allergy. 2023 Jul 13. Online ahead of print.
3. Clin Exp Med. 2023 Jul 1. Online ahead of print.

Background

IL-31 which produced by activated Th2-type T cells. IL-31 signals through a receptor composed of IL-31 receptor A and oncostatin M receptor. IL-31 activates STAT3 and possibly STAT1 and STAT5 through the IL31 heterodimeric receptor composed of IL31RA and OSMR. IL-31 has also been identified as a major player in a number of chronic inflammatory diseases, including atopic dermatitis. Patients with atopic dermatitis, chronic spontaneous urticaria, allergic contact dermatitis, prurigo nodularis, primary cutaneous lymphoma and mastocytosis exhibit increased serum levels of IL-31 protein and elevated IL-31 mRNA in the skin.

Picture

Bioactivity

Dose-dependent changes in STAT3 phosphorylation by DH-82 cells in response to Recombinant Canine IL-31 His,The EC50 for this effect is 80- 200ng/mL in the presence of 20ng/mL Recombinant Canine IFN-γ.

SDS-PAGE

1μg ( R: reducing condition, N: non-reducing condition).

 


ELISA

Measured by its binding ability in a functional ELISA. When Recombinant Canine IL-31 His Tag is immobilized 2.5µg/mL (100µL/well), Recombinant Canine OSMR Fc Chimera binds with an EC50 of 0.02-0.04μg/ml.

Measured by its binding ability in a functional ELISA. When Recombinant Canine OSMR Fc Chimera  is immobilized 2.5µg/mL (100µL/well), Recombinant Canine IL-31 His tag binds with an EC50 of 1.2-1.4μg/ml.