Dose-dependent changes in STAT3 phosphorylation by DH-82 cells in response to IL-31 Protein, Canine (UA040130). The EC50 for this effect is 16-43ng/mL in the presence of 20ng/mL IFN-γ Protein, Canine (UA040165).
Product Details
Product Details
Product Specification
| Species | Canine |
| Synonyms | IL-31,IL31,Interleukin-31 |
| Accession | C7G0W1 |
| Amino Acid Sequence |
Ser24-Gln159 with C terminal 8*His MSHMAPTHQLPPSDVRKIILELQPLSRGLLEDYQKKETGVPESNRTLLLCLTSDSQPPRLNSSAILPYFRAIRPLSDKNIIDKIIEQLDKLKFQHEPETEISVPADTFECKSFILTILQQFSACLESVFKSLNSGPQHHHHHHHH |
| Expression System | E.coli |
| Molecular Weight | 17kDa (Reducing) |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4, 5% Trehalose. |
| Reconstitution | econstitute at 0.1-0.5mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage |
· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1. J Allergy Clin Immunol. 2023 Jul 13;S0091-6749(23)00888-6. Online ahead of print. |
Background
IL-31which produced by activated Th2-type T cells. IL-31 signals through a receptorcomposed of IL-31 receptor A and oncostatin M receptor. IL-31 activates STAT3and possibly STAT1 and STAT5 through the IL31 heterodimeric receptor composedof IL31RA and OSMR. IL-31 has also been identified as a major player in anumber of chronic inflammatory diseases, including atopic dermatitis. Patientswith atopic dermatitis, chronic spontaneous urticaria, allergic contactdermatitis, prurigo nodularis, primary cutaneous lymphoma and mastocytosisexhibit increased serum levels of IL-31 protein and elevated IL-31 mRNA in theskin.
Picture
Picture
Bioactivity

SDS-PAGE

1μg ( R: reducing condition, N: non-reducing condition).
ELISA

Measured by its binding ability in a functional ELISA. When Recombinant Canine IL-31 His Tag is immobilized 2.5µg/mL (100µL/well), Recombinant Canine OSMR Fc Chimera binds with an EC50 of 0.02-0.04μg/ml.

Measured by its binding ability in a functional ELISA. When Recombinant Canine OSMR Fc Chimera is immobilized 2.5µg/mL (100µL/well), Recombinant Canine IL-31 His tag binds with an EC50 of 1.2-1.4μg/ml.
