Skip to product information
1 of 1

Human TMED4 Protein, His Tag

Human TMED4 Protein, His Tag

Catalog Number: S0A0196 Brand: Starter
Price:
Regular price $110.00 SGD
Regular price Sale price $110.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Transmembrane emp24 domain-containing protein 4, Endoplasmic reticulum stress-response protein 25 (ERS25), GMP25iso, Putative NF-kappa-B-activating protein 156, p24 family protein alpha-3 (p24alpha3), ERS25
Accession Q7Z7H5
Amino Acid Sequence

Protein sequence (Q7Z7H5, Leu30-Arg194, with C-His Tag) LYFHIGETEKRCFIEEIPDETMVIGNYRTQMWDKQKEVFLPSTPGLGMHVEVKDPDGKVVLSRQYGSEGRFTFTSHTPGDHQICLHSNSTRMALFAGGKLRVHLDIQVGEHANNYPEIAAKDKLTELQLRARQLLDQVEQIQKEQDYQRYREERFRLTSESTNQR

Expression System HEK293
Molecular Weight Predicted MW: 20.9 kDa Observed MW: 20 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Transmembrane emp24 domain-containing protein 4 (TMED4) is a member of the p24 family of type I transmembrane proteins, which are involved in endoplasmic reticulum (ER)-to-Golgi vesicular transport. It functions as a cargo receptor, facilitating the selective packaging of glycosylphosphatidylinositol (GPI)-anchored proteins and other specific clients into COPII-coated transport vesicles. TMED4 forms hetero-oligomeric complexes with other family members to ensure efficient cargo sorting and maintenance of cellular homeostasis. Its role is crucial for proper protein secretion and cellular trafficking pathways. Dysregulation of TMED4 has been implicated in certain diseases, including cancer.

Picture

SDS-PAGE

2μg(R: reducing conditions)