Skip to product information
1 of 2

Human IFN-α2, His Tag

Human IFN-α2, His Tag

Catalog Number: S0A4005 Brand: Starter
Price:
Regular price $250 USD
Regular price Sale price $250 USD
Size:

For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Interferon alpha-2, Interferon alpha-A,IFNA2
Accession P01563
Amino Acid Sequence

Protein sequence(P01563, Cys24-Glu188, with C-10*His) CDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKEGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:20.9kDa Actual:20,24kDa
Purity

>95% by SDS-PAGE

Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.

Please avoid repeated freeze-thaw cycles. 

Background

Human interferon alpha-2 (IFNα2) is a cytokine belonging to the family of type I IFNs. IFNα2 is a protein secreted by cells infected by a virus and acting on other cells to inhibit viral infection.IFNα2 was the first subtype to be characterized in the early eighties. As a result, IFNα2 was widely used in basic research to elucidate biological activities, structure and mechanism of action of type I IFNs. IFNα2 was also the first IFN to be produced by the pharmaceutical industry for use as a drug.In addition to their antiviral activity, type I IFNs also inhibit the proliferation of cells and regulate the activation of the immune system.

Picture

Bioactivity

Immobilized Human IFN-α2, His Tag at 4 μg/mL (50 μL/well) can bind Recombinant Human IFNAR2 Protein with EC50 of 0.214-0.257 μg/ ml.

SDS-PAGE

2μg (R: reducing conditions)