Skip to product information
1 of 5

CTLA-4 His Tag Protein, Human

CTLA-4 His Tag Protein, Human

Catalog Number: UA010077 Brand: UA BIOSCIENCE
Price:
Regular price $274.00 SGD
Regular price Sale price $274.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Cytotoxic T-lymphocyte-associated protein 4
Accession P16410
Amino Acid Sequence Ala37 - Phe162, with C-terminal 10*His AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight 20-27kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Cytotoxic T-lymphocyte-associated protein 4 (CTLA-4) is an inhibitory receptor belonging to the CD28 immunoglobulin subfamily, expressed primarily by T-cells. The family includes CD28, CTLA-4 and ICOS as well as other proteins including PD-1, BTLA and TIGIT.Its ligands, CD80 and CD86, are typically found on the surface of antigen-presenting cells and can either bind CD28 or CTLA-4, resulting in a costimulatory or a co-inhibitory response, respectively. Because of its dampening effect, CTLA-4 is a crucial regulator of T-cell homeostasis and self-tolerance. The mechanisms by which CTLA-4 exerts its inhibitory function can be categorized as either cell-intrinsic (affects the CTLA-4 expressing T-cell) or cell-extrinsic (affects secondary cells). CTLA-4 mainly acts in a cell-extrinsic manner via its competition with CD28, CTLA-4-mediated trans-endocytosis of CD80 and CD86, and its direct tolerogenic effects on the interacting cell.

Picture

Bioactivity

Immobilized CTLA-4 His Tag, Human (Cat. No. UA010077) at 2μg/ml (100μl/well) can bind B7-1/CD80 Fc Chimera, Human (Cat. No. UA010031) with EC50 of 11.58ng/ml.
Anti-His antibody Immobilized on CM5 Chip captured CTLA-4 His Tag, Human (Cat. No. UA010077), can bind B7-1/CD80 Fc Chimera, Human (Cat. No. UA010031) with an affinity constant of 12.45nM as determined in SPR assay.
Anti-His antibody Immobilized on CM5 Chip captured CTLA-4 His Tag, Human (Cat. No. UA010077), can bind B7-2/CD86 Fc Chimera, Human (Cat. No. UA010187) with an affinity constant of 0.12 μM as determined in SPR assay.
Immobilized CTLA-4 His Tag, Human (Cat. No. UA010077) at 1.5μg/mL (100μL/well) can bind B7-2/CD86 Fc Chimera, Human (Cat. No. UA010187) with EC50 of 0.074-0.094μg/ml.

SDS-PAGE

1μg(R: reducing conditions, N: non-reducing conditions).