Skip to product information
1 of 5

CD155/PVR His Tag Protein, Human

CD155/PVR His Tag Protein, Human

Catalog Number: UA010069 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $575.00 SGD
Regular price Sale price $575.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Accession P15151
Amino Acid Sequence

Trp21-Asn343, with C-terminal 6*His WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRNHHHHHH

Expression System HEK293
Molecular Weight 65-75kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

CD155 is a member of the immunoglobulin superfamily also known as the human receptor for poliovirus (PVR). The full length (or PVR alpha isoform) is synthesized as a 417 amino acid (aa) precursor that contains a 20aa signal sequence, a 323aa extracellular region, a 24aa TM segment and a 50aa cytoplasmic tail. It has been demonstrated that CD155 can be recognized and bond by DNAM-1 and CD96 which promote the adhesion, migration and NK-cell killing, and thus efficiently prime cell-mediated tumor-specific immunity. CD155 is expressed at high levels in several human malignancies and seems to have pro tumorigenic and therapeutically attractive properties that are currently being investigated in the field of recombinant oncolytic viro therapy. More intriguingly, PVR participates in a considerable number of immunoregulatory functions through its interactions with activating and inhibitory immune cell receptors. These functions are often modified in the tumor microenvironment, contributing to tumor immunosuppression.

Picture

SDS-PAGE

2μg(R: reducing conditions, N: non-reducing conditions).

ELISA

Immobilized CD155/PVR His Tag, Human (Cat. No. UA010069) at 2.0μg/mL (100μL/well) can bind DNAM-1/CD226 Fc Chimera, Human (Cat. No. UA010560) with EC50 of 4.48-13.43μg/ml.

SPR

Anti-His antibody Immobilized on CM5 Chip captured CD155/PVR His Tag, Human (Cat. No. UA010069), can bind TIGIT Fc Chimera, Human (Cat. No. UA010011) with an affinity constant of 11.44nM as determined in SPR assay.


Protein A Chip captured DNAM-1/CD226 Fc Chimera, Human(Cat. No. UA010560), can bind CD155/PVR His Tag, Human(Cat. No. UA010069) with an affinity constant of 1.28μM as determined in SPR assay.