Skip to product information
1 of 1

SARS-CoV-2 (KP.2/Omicron) RBD Protein, His tag

SARS-CoV-2 (KP.2/Omicron) RBD Protein, His tag

Catalog Number: S0A2076 Reactivity: Viral Conjugation: Unconjugated Brand: Starter
Price:
Regular price $196.00 SGD
Regular price Sale price $196.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species SARS-CoV-2
Synonyms Spike glycoprotein, S glycoprotein, E2, Peplomer protein
Accession P0DTC2
Amino Acid Sequence

Protein sequence (P0DTC2, Arg319-Lys537, with C-His tag) RVQPTESIVRFPNVTNLCPFHEVFNATRFASVYAWNRTRISNCVADYSVLYNFAPFFAFKCYGVSPTKLNDLCFTNVYADSFVIKGNEVSQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSKHSGNYDYWYRSLRKSKLKPFERDISTEIYQAGNKPCKGKGPNCYFPLQSYGFRPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVKNK

Expression System HEK293
Molecular Weight

Predicted MW: 26.4 kDa Observed MW: 35-40 kDa

Purity >90% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

KP.2 strain, a descendant of the highly contagious JN.1 variant. KP.2 is one of several variants being referred to as “FLiRT variants,” named after the technical names for their mutations. They are characterized by a phenylalanine (F) to leucine (L) mutation and an arginine (R) to threonine (T) mutation in the virus's spike protein. Sars-cov-2 infects human respiratory epithelial cells through binding to human ACE2 receptors. Spike protein is a large type I transmembrane protein containing two subunits S1 and S2. S1 mainly contains a receptor binding domain (RBD), which is responsible for recognizing cell surface receptors. S2 contains the basic elements required for membrane fusion. S protein plays a key role in inducing neutralizing antibody and T cell responses as well as protective immunity.

Picture

Bioactivity

Immobilized SARS-CoV-2 (KP.2/Omicron) RBD Protein, His tag at 4 μg/mL (50 μL/well) can bind Human ACE2, hFc tag (Cat. No. S0A0071) with EC50 of 31.52-35.11 ng/ml.

SDS-PAGE

2 μg(R: reducing conditions)