Skip to product information
1 of 1

Monkeypox virus M1R, His Tag

Monkeypox virus M1R, His Tag

Catalog Number: S0A2014 Brand: Starter
Price:
Regular price $392.00 SGD
Regular price Sale price $392.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species MPXV
Synonyms Mpox, Monkeypox
Accession Q80KX3
Amino Acid Sequence

Protein sequence(Q80KX3, Gly2-Gly183, with C-10*His)


GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNITVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAGTGGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 21kDa Actual: 22-30kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

M1R is the homolog of Vaccinia virus protein L1R. It has previously been shown that the product of the VV L1R is essential for the formation of intracellular mature virions and plays a role in virion morphogenesis. In the absense of L1R, only immature virion particles are formed and proteolytic cleavage of core proteins does not occur.

Picture

SDS-PAGE

2μg (R: reducing conditions)