Skip to product information
1 of 2

Monkeypox virus A35R, His Tag

Monkeypox virus A35R, His Tag

Catalog Number: S0A2013 Brand: Starter
Price:
Regular price $222.00 SGD
Regular price Sale price $222.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species MPXV
Synonyms Mpox, Monkeypox
Accession Q80KX2
Amino Acid Sequence

Protein sequence(Q80KX2, Val57-Thr181, with C-10*His)


VRLNQCMSANEAAITDSAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYKSFEDAKANCAAESSTLPNKSDVLTTWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCTGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 15.4kDa Actual: 15kDa
Purity

>95% by SDS-PAGE

Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Monkeypox A35R is a homolog of Vaccinia virus A33R protein. A33R is specifically incorporated into the viral outer envelope. The protein is expressed early and late after infection, cosistent with putative early and late promoter sequences. And it is necessay for efficient cell-to-cell spread.

Picture

Bioactivity

Immobilized Monkeypox virus A35R, His Tag at 0.5μg/ml (100ul/well) can bind to Monkeypox virus (MPXV A35R) Human mAb (S0B1002) with a linear range of 0.001-0.05 μg/ml.

SDS-PAGE

2μg (R: reducing conditions)