Skip to product information
1 of 2

Monkeypox virus A29L, His Tag

Monkeypox virus A29L, His Tag

Catalog Number: S0A2016 Brand: Starter
Price:
Regular price $392.00 SGD
Regular price Sale price $392.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species MPXV
Synonyms A29L, Mpox, Monkeypox
Accession Q9YN60
Amino Acid Sequence

Protein sequence(Q9YN60, Met1-Glu110 with C-10*His)


MDGTLFPGDDDLAIPATEFFSTKAAKNPETKREAIVKAYGDDNEETLKQRLTNLEKKITNITTKFEQIEKCCKHNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYEGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 14.2kDa Actual: 16-23kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

A29L is highly homologous to Vaccinia virus envelope protein A27. A27 has multiple functions and is conserved in the Orthopoxvirus genus of the poxvirus family. A27 protein binds to cell surface heparan sulfate, provides an anchor for A26 protein packaging into mature virions, and is essential for egress of mature virus (MV) from infected cells. 

Picture

Bioactivity

Immobilized Monkeypox virus A29L, His Tag at 5 μg/mL (50 μL/well) can bind A29L Recombinant Rabbit mAb(SDT-151-110) (S0B3006) with EC50 of 7.417-10.57 ng/mL.

SDS-PAGE

2μg (R: reducing conditions)