Skip to product information
1 of 1

HRSVL (strain Long) Glycoprotein G Protein, His Tag

HRSVL (strain Long) Glycoprotein G Protein, His Tag

Catalog Number: UA030063 Reactivity: Viral Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $1,266.00 SGD
Regular price Sale price $1,266.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species HRSV
Antigen Glycoprotein G
Synonyms HRSV Glycoprotein G, Glycoprotein GP55, Envelope glycoprotein B
Accession P20895
Amino Acid Sequence

His67-Gln298, with C-terminal 8*His HKVTLTTAIIQDATSQIKNTTPTYLTQDPQLGISFSNLSEITSQTTTILASTTPGVKSNLQPTTVKTKNTTTTQTQPSKPTTKQRQNKPPNKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKKTTTKPTKKPTFKTTKKDHKPQTTKPKEVPTTKPTEEPTINTTKTNIITTLLTNNTTGNPKLTSQMETFHSTSSEGNLSPSQVSTTSEHPSQPSSPPNTTRQGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 55-95kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Melero J A. et al. (1997) Antigenic structure, evolution and immunobiology of human respiratory syncytial virus attachment (G) protein. J Gen Virol. 78 (10): 2411-2418.

2、Trento A. (2006) Natural history of human respiratory syncytial virus inferred from phylogenetic analysis of the attachment (G) glycoprotein with a 60-nucleotide duplication. J Virol. 80(2): 975-984.

Background

Human respiratory syncytial virus (HRSV) is a major cause of lower respiratory tract disease in babies and vulnerable adults. The viral genome, a negative-sense single-stranded RNA molecule, encodes at least 11 distinct proteins, two of which (G and F) are the major surface glycoproteins anchored in the viral membrane. The G glycoprotein is the attachment protein that mediates virus binding to cells. The F glycoprotein mediates fusion of the viral and cell membranes for virus entry into the cell and fusion of the infected cell membrane with that of adjacent cells to pro mote syncytia formatio A characteristic feature of HRSV is that moderate levels of antibody do not provide lasting protection, although prior infection can modulate the severity of the disease. HSRV is classified in the genus Pneumovirus, subfamily Pneumovirinae, family Paramyxoviridae. Other members of this genus include RSV of cattle, goats and sheep, and pneumonia virus of mice (PVM).

Picture

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).