Skip to product information
1 of 1

HIV (HIV1-HXB2) P24 Protein, His tag

HIV (HIV1-HXB2) P24 Protein, His tag

Catalog Number: S0A2078 Reactivity: Viral Conjugation: Unconjugated Brand: Starter
Price:
Regular price $196.00 SGD
Regular price Sale price $196.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species HIV
Synonyms Gag polyprotein, Pr55Gag
Accession P04591
Amino Acid Sequence

Protein sequence (P04591, Pro133-Leu363, with C-His tag) PIVQNIQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKARVL

Expression System E.coli
Molecular Weight

Predicted MW: 27.4 kDa Observed MW: 25 kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

The P24 capsid protein is the most abundant HIV protein with each virus containing approximately 1,500 to 3,000 p24 molecules. It is the major structural protein within the capsid, and it is involved in maintaining the structural integrity of the virus and facilitating various stages of the viral life cycle, including viral entry into host cells and the release of new virus particles. Detection of p24 protein's antigen can be used to identify the presence of HIV in a person's blood. After approximately 50 days of infection, the p24 antigen is often cleared from the bloodstream entirely. The HIV-1 p24 capsid protein plays crucial roles throughout the replication cycle, making it an attractive therapeutic target.

Picture

SDS-PAGE

2 μg(R: reducing conditions)