Skip to product information
1 of 1

DENR His Tag, Human

DENR His Tag, Human

Catalog Number: S0A2064 Brand: Starter
Price:
Regular price $1,148.00 SGD
Regular price Sale price $1,148.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Antigen DENR
Synonyms Protein DRP1, Smooth muscle cell-associated protein 3 (SMAP-3)
Accession O43583
Amino Acid Sequence

Met1-Lys198, with N-terminal 8*His HHHHHHHHMAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK

Expression System E.coli
Molecular Weight 27kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Reference

1. Deyo J.E., Chiao P.J., Tainsky M.A. drp, a novel protein expressed at high cell density but not during growth arrest. DNA Cell Biol. 1998;17(5):437-447. 2. Oh J.J. Identification of differentially expressed genes associated with HER-2/neu overexpression in human breast cancer cells. Nucleic Acids Res. 1999;27(20):4008-4017. 3. Lomakin I.B. Crystal structure of the human ribosome in complex with DENR-MCT-1. Cell Rep. 2017;20(3):521-528. 4. Skabkin M.A. Activities of Ligatin and MCT-1/DENR in eukaryotic translation initiation and ribosomal recycling. Genes Dev. 2010;24(16):1787-1801. 5. Weisser, M., et al., Structural and functional insights into human re-initiation complexes. Mol Cell, 2017;67(3): p. 447-456.

Background

The density regulated protein (DENR) was discovered as a protein, whose synthesis is increased at high cell density. It is also overexpressed in breast and ovarian cancers. In translation, DENR functions as a stable heterodimer with malignant T-cell-amplified sequence 1, which interacts with the 40S ribosomal subunit during initiation, reinitiation and recycling stages. Diseases associated with DENR include Hypertrichosis Universalis Congenita, Ambras Type and Optic Nerve Disease.

Picture

SDS-PAGE

2μg (R: reducing condition, N: non-reducing condition).