2μg (R: reducing condition, N: non-reducing condition).
Product Details
Product Details
Product Specification
Species | Human |
Antigen | DENR |
Synonyms | Protein DRP1, Smooth muscle cell-associated protein 3 (SMAP-3) |
Accession | O43583 |
Amino Acid Sequence | Met1-Lys198, with N-terminal 8*His HHHHHHHHMAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK |
Expression System | E.coli |
Molecular Weight | 27kDa |
Purity | >95% by SDS-PAGE |
Endotoxin | <0.1EU/μg |
Conjugation | Unconjugated |
Tag | His Tag |
Physical Appearance | Lyophilized Powder |
Storage Buffer | PBS, pH7.4 |
Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles. |
Reference | 1. Deyo J.E., Chiao P.J., Tainsky M.A. drp, a novel protein expressed at high cell density but not during growth arrest. DNA Cell Biol. 1998;17(5):437-447. 2. Oh J.J. Identification of differentially expressed genes associated with HER-2/neu overexpression in human breast cancer cells. Nucleic Acids Res. 1999;27(20):4008-4017. 3. Lomakin I.B. Crystal structure of the human ribosome in complex with DENR-MCT-1. Cell Rep. 2017;20(3):521-528. 4. Skabkin M.A. Activities of Ligatin and MCT-1/DENR in eukaryotic translation initiation and ribosomal recycling. Genes Dev. 2010;24(16):1787-1801. 5. Weisser, M., et al., Structural and functional insights into human re-initiation complexes. Mol Cell, 2017;67(3): p. 447-456. |
Background
The density regulated protein (DENR) was discovered as a protein, whose synthesis is increased at high cell density. It is also overexpressed in breast and ovarian cancers. In translation, DENR functions as a stable heterodimer with malignant T-cell-amplified sequence 1, which interacts with the 40S ribosomal subunit during initiation, reinitiation and recycling stages. Diseases associated with DENR include Hypertrichosis Universalis Congenita, Ambras Type and Optic Nerve Disease.
Picture
Picture
SDS-PAGE

