Skip to product information
1 of 1

MUC-1(33-167) Fc Chimera Protein, Human

MUC-1(33-167) Fc Chimera Protein, Human

Catalog Number: UA010158 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $731.00 SGD
Regular price Sale price $731.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms CD227 antigen, CD227, DF3 antigen, EMA, Episialin, H23 antigen, H23AG, KL-6, MAM6, MUC-1, MUC1/ZD, Mucin-1,
Amino Acid Sequence

Ser33-Gly167, with C-terminal Human IgG1 Fc

SGHASSTPGGEKETSATQRSSVPSSTEKNAFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 87-113kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Mucin 1 (MUC1) is a highly glycosylated transmembrane protein expressed mainly on the apical surface of most glandular epithelial cells, including those of the mammary gland, lung, pancreas, kidney, female reproductive tract and stomach. It is also expressed on MM cell lines, fresh patient MM cells, and plasmacytomas, as well as other hematological malignancies, including Ki-1-positive B-cell lymphomas, T-cell lymphomas, Hodgkin's disease, and malignant histiocytosis. MUC1 functions primarily in the formation of a physical barrier to lubricate and protect normal epithelial tissues and mediate signal transduction. However, aberrant expression of MUC1 occurs in cancer cells, including those of esophageal cancer, gastric cancer, breast cancer, ovarian cancer, bladder cancer and other tumors, and is especially prominent in breast cancer cells. The biological structure of MUC1 consists of both a C-terminal fragment (MUC1-C) and an N-terminal fragment (MUC1-N) linked by non-covalent interactions. Furthermore, the C-terminal fragment comprises an extracellular region, a transmembrane region and an intracellular region. Among these regions, the transmembrane region (28 amino acids) and intracellular region (72 amino acids) are highly conserved. The N-terminal fragment is located on the membrane surface and contains the signal peptide, the (30–90) variable number tandem repeat (VNTR) region, and the sea urchin sperm protein, enterokinase and agrin (SEA) domain. Aberrantly glycosylated MUC1 is associated with cellular transformation from a normal to malignant phenotype in human cancers.  Furthermore, Muc-1 binds to intercellular adhesion molecule-1 (ICAM-1), suggesting a role in cellular migration.

Picture

SDS-PAGE

2μg (R: reducing conditions, N: non-reducing conditions).