Skip to product information
1 of 1

Human YWHAQ/14-3-3 theta Protein, His Tag

Human YWHAQ/14-3-3 theta Protein, His Tag

Catalog Number: S0A0201 Brand: Starter
Price:
Regular price $131.00 SGD
Regular price Sale price $131.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms 14-3-3 protein theta, 14-3-3 protein T-cell, 14-3-3 protein tau, Protein HS1, YWHAQ
Accession P27348
Amino Acid Sequence

Protein sequence (P27348, Met1-Asn245, with C-His Tag) MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN

Expression System E.coli
Molecular Weight

Predicted MW: 29.5 kDa Observed MW: 30 kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

YWHAQ, also known as 14-3-3 tau (τ), is a member of the highly conserved 14-3-3 family of phosphoserine/phosphothreonine-binding proteins. It functions as a key regulatory adapter molecule in eukaryotic cells. By binding to specific phosphorylated client proteins, YWHAQ modulates their activity, stability, subcellular localization, and participation in protein complexes. It is involved in a wide array of vital cellular processes, including signal transduction, cell cycle control, apoptosis, and metabolism. The protein plays a significant role in immune cell signaling and has been implicated in the pathogenesis of cancers and neurodegenerative diseases.

Picture

Bioactivity

Immobilized Human YWHAQ/14-3-3 theta Protein, His Tag at 2 μg/mL (100 μL/well) can bind 14-3-3 theta Rabbit polyclonal antibody (Cat. No. S0B0624) with EC50 of 8.2-9.1 ng/ml.

SDS-PAGE

2μg(R: reducing conditions)