Skip to product information
1 of 1

Human YWHAH/14-3-3 eta Protein, His Tag

Human YWHAH/14-3-3 eta Protein, His Tag

Catalog Number: S0A0205 Brand: Starter
Price:
Regular price $131.00 SGD
Regular price Sale price $131.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms 14-3-3 protein eta, Protein AS1, YWHA1
Accession Q04917
Amino Acid Sequence

Protein sequence (Q04917, Met1-Asn246, with C-His Tag) MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN

Expression System E.coli
Molecular Weight Predicted MW: 29.9 kDa Observed MW: 30 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

14-3-3 protein eta (YWHAH) is a prominent isoform within the conserved 14-3-3 family. It regulates diverse cellular processes by binding to phosphorylated serine/threonine motifs on client proteins. This interaction allows it to modulate target protein localization, stability, and activity. 14-3-3 eta is critically involved in signal transduction, cell cycle control, and apoptosis. Notably, it plays a specialized role in neuronal function and survival. Its dysregulation is linked to major pathological conditions, including cancer and neurodegenerative diseases like Parkinson's. Furthermore, 14-3-3 eta has emerged as a valuable biomarker in rheumatoid arthritis, where its detection in serum aids diagnosis.

Picture

SDS-PAGE

2μg(R: reducing conditions)