Skip to product information
1 of 2

Galectin-3 His Tag Protein, Human

Galectin-3 His Tag Protein, Human

Catalog Number: UA010129 Reactivity: Human Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $824.00 SGD
Regular price Sale price $824.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Gal-3
Accession P17931
Amino Acid Sequence

Ala2-Ile250, with C-terminal 6*His

ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMIHHHHHH

Expression System HEK293
Molecular Weight

35-41kDa (Reducing)

Purity

>95% by SDS-PAGE&RP-HPLC

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Galectin-3 (Gal-3) is a member of the galectin family of carbohydrate binding proteins which have affinity for beta-galactoside. Gal-3 is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. Gal-3 can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. Gal-3 is expressed in the nucleus, cytoplasm, mitochondrion, cell surface and extracellular space. Gal-3 plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation and exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants. Gal-3 plays an important role in the pathogenesis of neuroinflammatory and neurodegenerative disorders, such as multiple sclerosis, Alzheimer's disease, Parkinson's disease, and Huntington's disease. On the other hand, there is also evidence of the protective role of Gal-3 due to its anti-apoptotic effect in target cells.

Picture

SDS-PAGE

2μg (R: reducing conditions, N: non-reducing conditions).

RP-HPLC

ELISA

Immobilized Galectin-3 His Tag, Human  (Cat. No. UA010129) at 2.0μg/mL (100μL/well) can bind Galectin-3 Recombinant Rabbit mAb (SDT-370-78) (Cat. No. S0B3134)  with EC50 of 1.74-2.61ng/mL.