Skip to product information
1 of 2

FOLR1 His Tag Protein, Mouse

FOLR1 His Tag Protein, Mouse

Catalog Number: UA010091 Reactivity: Mouse Conjugation: Unconjugated Brand: UA BIOSCIENCE
Price:
Regular price $835.00 SGD
Regular price Sale price $835.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Accession P35846
Amino Acid Sequence

Thr25-Ser232, with C-terminal 8*His TRARTELLNVCMDAKHHKEKPGPEDNLHDQCSPWKTNSCCSTNTSQEAHKDISYLYRFNWNHCGTMTSECKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERILDVPLCKEDCQQWWEDCQSSFTCKSNWHKGWNWSSGHNECPVGASCHPFTFYFPTSAALCEEIWSHSYKLSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAEAMSGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 28-40kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Folate receptor alpha (FOLR1), a member of the folate receptor family, is a secreted protein that either anchors to membranes via a glycosyl-phosphatidylinositol linkage or exists in a soluble form with high affinity for binding folate and its reduced derivatives into cells and transport 5-methyltetrahydrofolate into cells. Folate is a necessary component of cell metabolism. Overexpression of FOLR1 may confer a growth advantage to tumors by increasing folate uptake and/or may affect cell proliferation via alternative cell signaling pathways. In healthy individuals, FOLR1 expression is often limited to the apical surfaces of epithelium in the lung, kidney and choroid plexus but is overexpressed in a variety of solid tumours such as ovarian cancer, non-small cell lung cancer, breast cancer, kidney cancer and high-grade osteosarcoma.

Picture

Bioactivity

Immobilized Folic acid-BSA at 2.0μg/mL (100μL/well) can bind FOLR1 His Tag, Mouse (Cat. No. UA010091) with EC50 of 3.05-4.02μg/ml.

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).