Skip to product information
1 of 2

Biotinylated PD-L1 Avi&His Tag Protein, Human

Biotinylated PD-L1 Avi&His Tag Protein, Human

Catalog Number: UA010541 Reactivity: Human Conjugation: Biotin Brand: UA BIOSCIENCE
Price:
Regular price $490 USD
Regular price Sale price $490 USD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Antigen PD-L1
Synonyms PD-L1, CD274, B7-H1, PDCD1L1, PDCD1LG1
Accession Q9NZQ7
Amino Acid Sequence

Phe19-Arg238, with C-terminal Avi&His Tag FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERGGGSGLNDIFEAQKIEWHEHHHHHHHH

Expression System HEK293
Molecular Weight 33-40kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Biotin
Tag Avi Tag, His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Joel Sunshine, Janis M Taube: PD-1/PD-L1 inhibitors, Current Opinion in Pharmacology, Volume 23, August 2015, Pages 32-38.

Background

PDL1 is a cell surface immunoglobulin superfamily with two Ig-like domains within the extracellular region and a short cytoplasmic domain. PDL1 is also known as B7-H, B7H1, MGC142294, MGC142296, PD-L1, PDCD1L1 and PDCD1LG1,which is a member of the growing B7 family of immune molecules and is involved in the regulation of cellular and humoral immune responses. PD-L1 provides a molecular stop signal to the adaptive immune system helping to distinguish between self and foreign antigens. PDL1 may inhibit ongoing T-cell responses by inducing apoptosis and arresting cell-cycle progression. Many cancers exhibit upregulated PD-L1 protein expression, and several cancers with high levels of PD-L1 have been associated with increased tumor aggressiveness and poor prognosis. Using new therapeutics that block the PD-L1:PD-1 interaction has proven successful in the clinic for many cancer types and has sparked great interest in the field of cancer immunotherapy.

Picture

SDS-PAGE

1μg (R: reducing conditions, N: non-reducing conditions).

ELISA

Immobilized Biotinylated PD-L1 Avi&His Tag, Human (Cat. No. UA010541) at 2 μg/mL on Streptavidin precoated (0.5μg/well) plate, can bind PD-1 Fc Chimera, Human (Cat. No. UA010002) with EC50 of 1.21-1.70 ng/ml.

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)