Skip to product information
1 of 1

Staphylococcus aureus Protein A (B), His tag

Staphylococcus aureus Protein A (B), His tag

Catalog Number: S0A0109 Reactivity: Other Conjugation: Brand: Starter
Price:
Regular price $222.00 SGD
Regular price Sale price $222.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Staphylococcus aureus
Synonyms IgG-binding protein A, Staphylococcal protein A (SpA), spa
Accession P02976
Amino Acid Sequence

Protein sequence (P02976, Met212-Lys269, with C-His tag) MADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPK

Expression System E.coli
Molecular Weight Predicted MW: 8.4 kDa Observed MW: 8.4 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Protein A is a 42 kDa surface protein originally found in the cell wall of the bacteria Staphylococcus aureus. It is encoded by the spa gene and its regulation is controlled by DNA topology, cellular osmolarity, and a two-component system called ArlS-ArlR. It has found use in biochemical research because of its ability to bind immunoglobulins. It is composed of five homologous Ig-binding domains that fold into a three-helix bundle. Each domain is able to bind proteins from many mammalian species, most notably IgGs. It binds the heavy chain within the Fc region of most immunoglobulins and also within the Fab region in the case of the human VH3 family. Through these interactions in serum, where IgG molecules are bound in the wrong orientation (in relation to normal antibody function), the bacteria disrupts opsonization and phagocytosis.

Picture

Bioactivity

Immobilized Human IgG1 Fc (Cat. No. S0A0052) at 4 μg/mL (50 μL/well) can bind Staphylococcus aureus Protein A (B), His tag with EC50 of 7.864-9.985 ng/ ml.

Immobilized Human IgG2 Fc (Cat. No. S0A0053) at 20 μg/mL (50 μL/well) can bind Staphylococcus aureus Protein A (B), His tag with EC50 of 12.95-15.57 ng/ ml.

SDS-PAGE

2 μg(R: reducing conditions)