Skip to product information
1 of 1

Mouse PSD95 Protein, His tag

Mouse PSD95 Protein, His tag

Catalog Number: S0A0120 Reactivity: Mouse Conjugation: Unconjugated Brand: Starter
Price:
Regular price $239.00 SGD
Regular price Sale price $239.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Mouse
Synonyms Disks large homolog 4, Postsynaptic density protein 95(PSD-95), Synapse-associated protein 90 (SAP-90; SAP90), Dlg4, Dlgh4, Psd95
Accession Q62108
Amino Acid Sequence

Protein sequence (Q62108, Glu65-Lys299, with C-His tag) EITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKIIEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAK

Expression System HEK293
Molecular Weight Predicted MW: 26.8 kDa Observed MW: 30-50 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

PSD-95 (postsynaptic density protein 95) also known as SAP-90 (synapse-associated protein 90). PSD-95 is a member of the membrane-associated guanylate kinase (MAGUK) family. With PSD-93 it is recruited into the same NMDA receptor and potassium channel clusters. These two MAGUK proteins may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins. Like all MAGUK-family proteins, its basic structure includes three PDZ domains, an SH3 domain, and a guanylate kinase-like domain (GK) connected by disordered linker regions. It is almost exclusively located in the post synaptic density of neurons, and is involved in anchoring synaptic proteins. Its direct and indirect binding partners include neuroligin, NMDA receptors, AMPA receptors, and potassium channels. It plays an important role in synaptic plasticity and the stabilization of synaptic changes during long-term potentiation.

Picture

SDS-PAGE

2 μg(R: reducing conditions)