Skip to product information
1 of 1

Human YWHAG/14-3-3 gamma Protein, His Tag

Human YWHAG/14-3-3 gamma Protein, His Tag

Catalog Number: S0A0204 Brand: Starter
Price:
Regular price $131.00 SGD
Regular price Sale price $131.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms 14-3-3 protein gamma, Protein kinase C inhibitor protein 1 (KCIP-1)
Accession P61981
Amino Acid Sequence

Protein sequence (P61981, Met1-Asn247, with C-His Tag) MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN

Expression System E.coli
Molecular Weight Predicted MW: 30 kDa Observed MW: 30 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

The 14-3-3 protein gamma (YWHAG) is a crucial member of the highly conserved 14-3-3 protein family, which is ubiquitously expressed in eukaryotic cells. It functions as a key regulatory module by binding to client proteins that are phosphorylated on specific serine or threonine residues. Through these interactions, 14-3-3 gamma modulates a wide array of vital cellular processes, including signal transduction, cell cycle control, apoptosis, and neuronal development. It acts by inducing conformational changes in its targets, altering their subcellular localization, stability, or enzymatic activity. Dysregulation of 14-3-3 gamma is implicated in various human diseases, notably cancer and neurological disorders.

Picture

SDS-PAGE

2μg(R: reducing conditions)