Skip to product information
1 of 2

Human Thrombopoietin, His tag

Human Thrombopoietin, His tag

Catalog Number: S0A0029 Brand: Starter
Price:
Regular price $131.00 SGD
Regular price Sale price $131.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms C-mpl ligand (ML), Megakaryocyte colony-stimulating factor, Megakaryocyte growth and development factor (MGDF), Myeloproliferative leukemia virus oncogene ligand, THPO, MGDF
Accession P40225
Amino Acid Sequence

Protein sequence(P40225, Ser22-Gly353, with C-10*His) SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEGGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

Theoretical:37.1kDa Actual:75-90kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months,

-20 to -70 °C under sterile conditions after reconstitution.

1 week, 2 to 8 °C under sterile conditions after reconstitution.

Please avoid repeated freeze-thaw cycles.

Background

Thrombopoietin (THPO) also known as megakaryocyte growth and development factor (MGDF) is a protein that in humans is encoded by the THPO gene. Thrombopoietin is a glycoprotein hormone produced by the liver and kidney which regulates the production of platelets. It stimulates the production and differentiation of megakaryocytes, the bone marrow cells that bud off large numbers of platelets. Megakaryocytopoiesis is the cellular development process that leads to platelet production. Thrombopoietin is a humoral growth factor necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis.

Picture

Bioactivity

Measured in a cell proliferation assay using Mo7e cells. The ED50 for this effect is 1-2 ng/mL.

SDS-PAGE

2μg (R: reducing conditions)