Skip to product information
1 of 1

Human REG1A Protein, His Tag

Human REG1A Protein, His Tag

Catalog Number: S0A6070 Brand: Starter
Price:
Regular price $111.00 SGD
Regular price Sale price $111.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Lithostathine-1-alpha, Islet cells regeneration factor (ICRF), Islet of Langerhans regenerating protein (REG), Pancreatic stone protein (PSP), Pancreatic thread protein (PTP), Regenerating islet-derived protein 1-alpha (REG-1-alpha), Regenerating protein I alpha, PSPS, PSPS1, REG
Accession P05451
Amino Acid Sequence

Protein sequence (P05451, Gln23-Asn166, with C-His Tag) QEAQTELPQARISCPEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSVNPGYCVSLTSSTGFQKWKDVPCEDKFSFVCKFKN

Expression System HEK293
Molecular Weight Predicted MW: 18 kDa Observed MW: 18 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Lithostathine-1-alpha, also known as Regenerating islet-derived protein 1 alpha (REG1A), is a secreted protein encoded by the REG1A gene. It is primarily produced by the pancreas and plays a role in promoting cell proliferation and regeneration. Its name originates from its initial identification as a protein that inhibits calcium carbonate crystal formation, potentially preventing pancreatic stone formation. However, its primary significance lies in its function as a acute-phase reactant and its strong association with inflammatory and malignant conditions. REG1A is markedly overexpressed in diseases such as chronic pancreatitis and pancreatic ductal adenocarcinoma, making it a promising biomarker for early detection and monitoring of these conditions.

Picture

SDS-PAGE

2μg(R: reducing conditions)