Skip to product information
1 of 1

Human PTP1B Protein, His tag

Human PTP1B Protein, His tag

Catalog Number: S0A0168 Reactivity: Human Conjugation: Unconjugated Brand: Starter
Price:
Regular price $307.00 SGD
Regular price Sale price $307.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Tyrosine-protein phosphatase non-receptor type 1, Protein-tyrosine phosphatase 1B (PTP-1B), PTPN1
Accession P18031
Amino Acid Sequence

Protein sequence (P18031, Met1-Asp298, with C-His tag) MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHED

Expression System E.coli
Molecular Weight Predicted MW: 36.4 kDa Observed MW: 35 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Protein - tyrosine phosphatase 1B (PTP1B) is a crucial enzyme belonging to the protein tyrosine phosphatase family. PTP1B is widely distributed in various tissues such as adipose, liver, muscle, and epithelial cells, mainly located in the endoplasmic reticulum of the cytoplasm. It specifically hydrolyzes the phosphate group on the phosphorylated tyrosine residue, maintaining the balance of tyrosine protein phosphorylation with protein tyrosine kinases and participating in cell signal transduction. PTP1B negatively regulates the insulin and leptin signaling pathways, and its over - expression is closely related to the occurrence of type 2 diabetes, obesity, and other diseases.

Picture

SDS-PAGE

2μg(R: reducing conditions)