Skip to product information
1 of 1

Human PRDM1/Blimp1 Protein, His tag

Human PRDM1/Blimp1 Protein, His tag

Catalog Number: S0A0175 Reactivity: Human Conjugation: Unconjugated Brand: Starter
Price:
Regular price $568.00 SGD
Regular price Sale price $568.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms PR domain zinc finger protein 1, BLIMP-1, Beta-interferon gene positive regulatory domain I-binding factor, PR domain-containing protein 1, Positive regulatory domain I-binding factor 1 (PRDI-BF1; PRDI-binding factor 1), BLIMP1
Accession O75626
Amino Acid Sequence

Protein sequence (O75626, Lys38-Gln223, with C-His tag) KMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSRGELHHFIDGFNEEKSNWMRYVNPAHSPREQNLAACQNGMNIYFYTIKPIPANQELLVWYCRDFAERLHYPYPGELTMMNLTQ

Expression System E.coli
Molecular Weight Predicted MW: 23.5 kDa Observed MW: 25 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Liquid
Storage Buffer

Supplied as a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 5% glycerol.

Stability & Storage

12 months from date of receipt, -20℃ as supplied.

Background

PRDM1 (PR domain zinc finger protein 1) is a transcription factor critical for cell fate determination and terminal differentiation. It plays a pivotal role in B cell development, driving mature B cells into antibody-secreting plasma cells while repressing B cell identity genes. Beyond immunity, PRDM1 regulates differentiation in other lineages, such as T cells and epithelial cells, and acts as a tumor suppressor in multiple cancers by inhibiting cell proliferation and inducing apoptosis. Dysregulation of PRDM1 is linked to lymphoid malignancies (e.g., multiple myeloma, diffuse large B-cell lymphoma) and solid tumors.

Picture

SDS-PAGE

2μg(R: reducing conditions)