Skip to product information
1 of 1

Human MSMP/PSMP Protein, His tag

Human MSMP/PSMP Protein, His tag

Catalog Number: S0A0138 Reactivity: Human Conjugation: Unconjugated Brand: Starter
Price:
Regular price $271.00 SGD
Regular price Sale price $271.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Prostate-associated microseminoprotein, PC3-secreted microprotein
Accession Q1L6U9
Amino Acid Sequence

Protein sequence (Q1L6U9, Lys37-Ser139, with C-His tag) KCYFQAQAPCHYEGKYFTLGESWLRKDCFHCTCLHPVGVGCCDTSQHPIDFPAGCEVRQEAGTCQFSLVQKSDPRLPCKGGGPDPEWGSANTPVPGAPAPHSS

Expression System HEK293
Molecular Weight

Predicted MW: 12.8 kDa Observed MW: 18 kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Microseminoprotein, prostate associated is a protein that in humans is encoded by the MSMP gene. This gene encodes a member of the beta-microseminoprotein family. Members of this protein family contain ten conserved cysteine residues that form intra-molecular disulfide bonds. The encoded protein may play a role in prostate cancer tumorigenesis. Predicted to enable CCR2 chemokine receptor binding activity. Predicted to be involved in lymphocyte chemotaxis and monocyte chemotaxis. Predicted to be active in cytoplasm and extracellular space.

Picture

SDS-PAGE

2μg(R: reducing conditions)