Skip to product information
1 of 1

Human MG53/TRIM72 Protein, His tag

Human MG53/TRIM72 Protein, His tag

Catalog Number: S0A0127 Reactivity: Human Conjugation: Unconjugated Brand: Starter
Price:
Regular price $144.00 SGD
Regular price Sale price $144.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Tripartite motif-containing protein 72, Mitsugumin-53 (Mg53)
Accession Q6ZMU5
Amino Acid Sequence

Protein sequence (Q6ZMU5, Met270-Ala475, with C-His tag) DDFKFQVWRKMFRALMPALEELTFDPSSAHPSLVVSSSGRRVECSEQKAPPAGEDPRQFDKAVAVVAHQQLSEGEHYWEVDVGDKPRWALGVIAAEAPRRGRLHAVPSQGLWLLGLREGKILEAHVEAKEPRALRSPERRPTRIGLYLSFGDGVLSFYDASDADALVPLFAFHERLPRPVYPFFDVCWHDKGKNAQPLLLVGPEGA

Expression System E.coli
Molecular Weight Predicted MW: 24.9 kDa Observed MW: 25 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

MG53 (also known as tripartite motif, TRIM72) is a cardiac and skeletal muscle-specific TRIM-family protein that exhibits multiple biologic functions. MG53 participates in plasma membrane repair of the heart, skeletal muscle, and, other tissues. MG53 is essentially involved in the cardioprotection of cardiac ischemic, preconditioning, and postconditioning by activating the PI3K-Akt-GSK3β and ERK1/2 survival signaling pathways. Systemic delivery of recombinant MG53 protein ameliorates the impact of a range of injury insults on the heart, skeletal muscle, lung, kidney, skin, and brain. It is noteworthy that chronic upregulation of MG53 induces insulin resistance and metabolic diseases, such as type 2 diabetes and its cardiovascular complications, by acting as an E3 ligase to mediate the degradation of insulin receptor and insulin receptor substrate-1. MG53 negatively regulates myogenesis.

Picture

SDS-PAGE

2 μg(R: reducing conditions)