Skip to product information
1 of 1

Human IgE, His tag

Human IgE, His tag

Catalog Number: S0A0102 Brand: Starter
Price:
Regular price $290.00 SGD
Regular price Sale price $290.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Ig epsilon chain C region, Ig epsilon chain C region ND, IGHE
Accession P01854
Amino Acid Sequence

Protein sequence (P01854, Lys208-Gly427, with C-His tag) KCADSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVNLTWSRASGKPVNHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVNPG

Expression System HEK293
Molecular Weight Predicted MW: 26.3 kDa Observed MW: 30 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Ig epsilon chain C region is a protein that in humans is encoded by the IGHE gene. IGHE has been predicted to enable antigen binding activity and immunoglobulin receptor binding activity. Predicted to be involved in several processes, including activation of immune response; defense response to other organism; and phagocytosis. IGHE has also been predicted to be located in extracellular region, a part of immunoglobulin complex, circulating, and active in external side of plasma membrane. Immunoglobulin E (IgE) are antibodies produced by the immune system. Each type of IgE has specific "radar" for each type of allergen. IgE-mediated food allergies is when the immune system reacts abnormally when exposed to one or more specific foods such as milk, egg, wheat or nuts.

Picture

Bioactivity

Immobilized Fc epsilon RI α Fc Chimera, Human (Cat. No. UA010147) at 0.5 μg/mL (100 μL/well) can bind Human IgE, His tag with EC50 of 0.885-1.402 ng/ml.

SDS-PAGE

2 μg(R: reducing conditions)