Skip to product information
1 of 1

Human GZMA protein, His tag

Human GZMA protein, His tag

Catalog Number: S0A0111 Reactivity: Human Conjugation: Unconjugated Brand: Starter
Price:
Regular price $196.00 SGD
Regular price Sale price $196.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Granzyme A, CTL tryptase, Cytotoxic T-lymphocyte proteinase 1, Fragmentin-1, Granzyme-1, Hanukkah factor (H factor; HF), CTLA3, HFSP
Accession P12544
Amino Acid Sequence

Protein sequence (P12544, Glu27-Val262, with C-His tag) EKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLMEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAV

Expression System HEK293
Molecular Weight

Predicted MW: 27.8 kDa Observed MW: 27.8 kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Granzyme A is a tryptase and is one of the five granzymes encoded in the human genome. This enzyme is present in cytotoxic T lymphocyte (CTL) granules. GzmA cleaves proteins after arginine or lysine basic residues. In CTL-targeted cells, it activates caspase-independent programmed cell death pathways that are unique and parallel to that of Granzyme B, although some substrates such as PARP-1 and lamin B are shared with Granzyme B. Substrates of GzmA include Pro-IL-1β, NDUFS3, SET, APE1, and Ku70 among others. In vitro studies suggest that GzmA may have less cytotoxic capabilities than GzmB. In colorectal cancer, GzmA was associated with promotion of cancer development, which may be due to activation of inflammation-inducing cytokines from macrophages.

Picture

SDS-PAGE

2 μg(R: reducing conditions)