Skip to product information
1 of 1

Human Fetuin A, His tag

Human Fetuin A, His tag

Catalog Number: S0A0099 Brand: Starter
Price:
Regular price $206.00 SGD
Regular price Sale price $206.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Alpha-2-Z-globulin, Ba-alpha-2-glycoprotein, AHSG, FETUA
Accession P02765
Amino Acid Sequence

Protein sequence (P02765, Ala19-Val367, with C-His tag) APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCMVFQTQPVSSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKV

Expression System HEK293
Molecular Weight Predicted MW: 39 kDa Observed MW: 55-60 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

alpha-2-HS-glycoprotein also known as fetuin-A belongs to the fetuin class of plasma binding proteins and is more abundant in fetal than adult blood. Alpha2-HS glycoprotein is synthesized by hepatocytes and adipocytes. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. The mature circulating AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. AHSG is a secreted partially phosphorylated glycoprotein with complex proteolytic processing that circulates in blood and extracellular fluids. Fetuins are carrier proteins like albumin. Fetuin-A forms soluble complexes with calcium and phosphate and thus is a carrier of otherwise insoluble calcium phosphate. Thus fetuin-A is a potent inhibitor of pathological calcification, in particular Calciphylaxis. High levels of Fetuin-A are associated with obesity and insulin resistance.

Picture

SDS-PAGE

2 μg(R: reducing conditions)