Skip to product information
1 of 1

Human CHODL Protein, His tag

Human CHODL Protein, His tag

Catalog Number: S0A0155 Reactivity: Human Conjugation: Unconjugated Brand: Starter
Price:
Regular price $303.00 SGD
Regular price Sale price $303.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Chondrolectin, Transmembrane protein MT75, C21orf68, PRED12
Accession Q9H9P2
Amino Acid Sequence

Protein sequence (Q9H9P2, Arg22-Ala211, with C-His tag) RRVVSGQKVCFADFKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWIGLWRNGDGQTSGACPDLYQWSDGSNSQYRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEINPTAPVEKPYLTNQPGDTHQNVVVTEA

Expression System HEK293
Molecular Weight Predicted MW: 23.2 kDa Observed MW: 34 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Chondrolectin is a type I membrane protein with a carbohydrate recognition domain characteristic of C-type lectins in its extracellular portion. This protein has been shown to localise to the perinucleus. The exact function of chondrolectin is unknown but it has been shown to be a marker of fast motor neurons in mice, and is involved in motor neuron development and growth in zebrafish (Danio rerio). Furthermore, human chondrolectin has been shown to localise to motor neurons within the spinal cord. Chondrolectin is alternatively spliced in the spinal cord of mouse models of the neuromuscular disease, spinal muscular atrophy (SMA), which predominantly affects lower motor neurons. Increased levels of chondrolectin in a zebrafish model of SMA results in significant improvements in disease-related motor neuron defects.

Picture

SDS-PAGE

2μg(R: reducing conditions)