Skip to product information
1 of 1

Human CELSR3 Protein, His tag

Human CELSR3 Protein, His tag

Catalog Number: S0A0164 Reactivity: Human Conjugation: Unconjugated Brand: Starter
Price:
Regular price $862.00 SGD
Regular price Sale price $862.00 SGD
Size:
For shipping services or bulk orders, you may request a quotation.
Secure checkout with
View full details

Product Details

Product Specification


Species Human
Synonyms Cadherin EGF LAG seven-pass G-type receptor 3, Cadherin family member 11, Epidermal growth factor-like protein 1 (EGF-like protein 1), Flamingo homolog 1 (hFmi1), Multiple epidermal growth factor-like domains protein 2 (Multiple EGF-like domains protein 2), CDHF11, EGFL1, FMI1, KIAA0812, MEGF2
Accession Q9NYQ7
Amino Acid Sequence

Protein sequence (Q9NYQ7, Arg71-His180, with C-His tag) REDGGPGLGVREPIFVGLRGRRQSARNSRGPPEQPNEELGIEHGVQPLGSRERETGQGPGSVLYWRPEVSSCGRTGPLQRGSLSPGALSSGVPGSGNSSPLPSDFLIRHH

Expression System HEK293
Molecular Weight Predicted MW: 13.3 kDa Observed MW: 17 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Cadherin EGF LAG seven-pass G-type receptor 3 is a member of the flamingo subfamily, part of the cadherin superfamily. The flamingo subfamily consists of nonclassic-type cadherins; a subpopulation that does not interact with catenins. The flamingo cadherins are located at the plasma membrane and have nine cadherin domains, seven epidermal growth factor-like repeats and two laminin A G-type repeats in their ectodomain. They also have seven transmembrane domains, a characteristic unique to this subfamily. It is postulated that these proteins are receptors involved in contact-mediated communication, with cadherin domains acting as homophilic binding regions and the EGF-like domains involved in cell adhesion and receptor-ligand interactions.

Picture

SDS-PAGE

2μg(R: reducing conditions)